PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK24363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 311aa    MW: 35377.4 Da    PI: 8.0857
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK24363.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54e-154188148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed +l+++vk++G g+W+++ ++  + R++k+c++rw ++l
       KFK24363.1 41 KGPWSSTEDGILINYVKKHGEGNWNAVQSHTSLARCGKSCRLRWANHL 88
                     79******************************************9986 PP

2Myb_DNA-binding54.13.5e-1794137146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ ++q+G++ W++ a++++ gRt++++k++w++
       KFK24363.1  94 KGAFSQEEEQLIVEMHAQMGNK-WARMAEHLP-GRTDNEIKNYWNT 137
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2243688IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-233891IPR009057Homeodomain-like
SMARTSM007176.6E-114090IPR001005SANT/Myb domain
SuperFamilySSF466898.63E-2940135IPR009057Homeodomain-like
PfamPF002491.5E-134188IPR001005SANT/Myb domain
CDDcd001673.24E-94388No hitNo description
PROSITE profilePS5129425.61489143IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2592142IPR009057Homeodomain-like
SMARTSM007179.4E-1793141IPR001005SANT/Myb domain
PfamPF002491.7E-1594137IPR001005SANT/Myb domain
CDDcd001672.22E-1296137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSYTTVESDD GMDSSIHYES PGADSIGNGC RSKGKGNVLK KGPWSSTEDG ILINYVKKHG  60
EGNWNAVQSH TSLARCGKSC RLRWANHLRP NLKKGAFSQE EEQLIVEMHA QMGNKWARMA  120
EHLPGRTDNE IKNYWNTRIK RRQRAGLPLY PSEIHDGDLQ WSEEYTKSNI IRVDRRRHQD  180
FLQLGNLKAN DLWEELNFAS SRLPGASDPS DLVACHMLRN GASSSRYESY MPPILPSPTT  240
LRDSGYRFPM CSSNIKQEFQ SPEHFQNTAQ QTNPRSCSIS PCDVDRPPYR SQHPFDMIPN  300
SHTFTDGMFP T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31391425107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195850.0AY519585.1 Arabidopsis thaliana MYB transcription factor (At3g11440) mRNA, complete cds.
GenBankBT0039400.0BT003940.1 Arabidopsis thaliana clone RAFL15-06-P04 (R20731) putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankBT0051200.0BT005120.1 Arabidopsis thaliana clone U20731 putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882732.10.0hypothetical protein ARALYDRAFT_478481
TrEMBLA0A087G3B10.0A0A087G3B1_ARAAL; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65